Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) |
Family c.71.1.0: automated matches [191485] (1 protein) not a true family |
Protein automated matches [190777] (28 species) not a true protein |
Species Escherichia coli [TaxId:83333] [267798] (11 PDB entries) |
Domain d4x5ha_: 4x5h A: [280477] automated match to d3jw3a_ complexed with bme, fol, nap |
PDB Entry: 4x5h (more details), 1.9 Å
SCOPe Domain Sequences for d4x5ha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4x5ha_ c.71.1.0 (A:) automated matches {Escherichia coli [TaxId: 83333]} misliaalavdrvigmenampwnlpadlawfkrntlnkpvimgrhtwesigrplpgrkni ilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaeve gdthfpdyepddwesvfsefhdadaqnshsycfeilerr
Timeline for d4x5ha_: