Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
Protein automated matches [190543] (131 species) not a true protein |
Species Thalassospira sp. [TaxId:1485225] [280473] (1 PDB entry) |
Domain d4v2ib_: 4v2i B: [280474] automated match to d1evqa_ complexed with mg |
PDB Entry: 4v2i (more details), 1.69 Å
SCOPe Domain Sequences for d4v2ib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4v2ib_ c.69.1.0 (B:) automated matches {Thalassospira sp. [TaxId: 1485225]} pvlepttqkfinalsasggpaiytltpaeardvlsgaqsgeiakpavditdttfavgptg atkvriirpqgntdrlpvivyfhgagwvmgdtgthdrlvrelsvranaalvfvdyerspe arypvaieqdyavtkyvaehseqlnvdptrlaiagdsvggnmtavvsllaqerggpdita qvlfypvtdadfdngsytefangpwltkpamdwfwnqylpegidrtdpkitpihatseql sgqapalvitaendvlrdegeayarklsqagvdvtvtryngtihdfvmlnvladtpaakg aiaqagqylhtalhg
Timeline for d4v2ib_: