SCOPe 2.08: Domain d4v2ib_: 4v2i B:

Lineage for d4v2ib_ (4v2i B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (131 species)
   not a true protein

7. Species Thalassospira sp. [TaxId:1485225] [280473] (1 PDB entry)

8. Domain d4v2ib_: 4v2i B: [280474]
   automated match to d1evqa_
   complexed with mg

Details for d4v2ib_

PDB Entry: 4v2i, 1.69 Å

PDB Description: biochemical characterization and structural analysis of a new cold- active and salt tolerant esterase from the marine bacterium thalassospira sp

PDB Compounds: (B:) Esterase/lipase

SCOPe Domain Sequences for d4v2ib_:

Sequence; same for both SEQRES and ATOM records:

>d4v2ib_ c.69.1.0 (B:) automated matches {Thalassospira sp. [TaxId: 1485225]}
pvlepttqkfinalsasggpaiytltpaeardvlsgaqsgeiakpavditdttfavgptg
atkvriirpqgntdrlpvivyfhgagwvmgdtgthdrlvrelsvranaalvfvdyerspe
arypvaieqdyavtkyvaehseqlnvdptrlaiagdsvggnmtavvsllaqerggpdita
qvlfypvtdadfdngsytefangpwltkpamdwfwnqylpegidrtdpkitpihatseql
sgqapalvitaendvlrdegeayarklsqagvdvtvtryngtihdfvmlnvladtpaakg
aiaqagqylhtalhg

Timeline for d4v2ib_:

• d4v2ib_ first appeared in SCOPe 2.05
  
• d4v2ib_ appears in SCOPe 2.07