Lineage for d5fpda1 (5fpd A:4-188)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1857400Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1857401Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1857402Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 1857787Protein automated matches [226905] (12 species)
    not a true protein
  7. 1857837Species Human (Homo sapiens) [TaxId:9606] [225574] (17 PDB entries)
  8. 1857877Domain d5fpda1: 5fpd A:4-188 [280452]
    automated match to d1atra1
    complexed with pza

Details for d5fpda1

PDB Entry: 5fpd (more details), 1.97 Å

PDB Description: structure of heat shock-related 70kda protein 2 with small-molecule ligand pyrazine-2-carboxamide (at513) in an alternate binding site.
PDB Compounds: (A:) heat shock-related 70kda protein 2

SCOPe Domain Sequences for d5fpda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fpda1 c.55.1.1 (A:4-188) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gpaigidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqvamnp
tntifdakrligrkfedatvqsdmkhwpfrvvseggkpkvqveykgetktffpeeissmv
ltkmkeiaeaylggkvhsavitvpayfndsqrqatkdagtitglnvlriineptaaaiay
gldkk

SCOPe Domain Coordinates for d5fpda1:

Click to download the PDB-style file with coordinates for d5fpda1.
(The format of our PDB-style files is described here.)

Timeline for d5fpda1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5fpda2