Lineage for d5fg4a_ (5fg4 A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1731436Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1731437Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 1731536Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 1731537Protein automated matches [190615] (7 species)
    not a true protein
  7. 1731541Species Human (Homo sapiens) [TaxId:9606] [187641] (258 PDB entries)
  8. 1731779Domain d5fg4a_: 5fg4 A: [280433]
    automated match to d4lc2a_
    complexed with 5xe

Details for d5fg4a_

PDB Entry: 5fg4 (more details), 1.65 Å

PDB Description: crystal structure of the bromodomain of human brpf1 in complex with of-1 chemical probe
PDB Compounds: (A:) Peregrin

SCOPe Domain Sequences for d5fg4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fg4a_ a.29.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mqltpflillrktleqlqekdtgnifsepvplsevpdyldhikkpmdfftmkqnleayry
lnfddfeedfnlivsnclkynakdtifyraavrlreqggavlrqarrqaekmg

SCOPe Domain Coordinates for d5fg4a_:

Click to download the PDB-style file with coordinates for d5fg4a_.
(The format of our PDB-style files is described here.)

Timeline for d5fg4a_: