SCOPe 2.07: Domain d5feab_: 5fea B:

Lineage for d5feab_ (5fea B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (14 species)
   not a true protein

7. Species Leishmania donovani [TaxId:981087] [274710] (2 PDB entries)

8. Domain d5feab_: 5fea B: [280429]
   automated match to d2dvva_
   complexed with bmf, br

Details for d5feab_

PDB Entry: 5fea, 2.6 Å

PDB Description: domain swapped bromodomain from leishmania donovani

PDB Compounds: (B:) Uncharacterized protein

SCOPe Domain Sequences for d5feab_:

Sequence; same for both SEQRES and ATOM records:

>d5feab_ a.29.2.0 (B:) automated matches {Leishmania donovani [TaxId: 981087]}
khahrqsletipevaelyhciyklyneeessvwfrepvnalaqeiftyydvvkspmslrh
ildnivkgdtystalqvmedveliwkncitfngansllateagkcrsaldrirrayqddq
r

Timeline for d5feab_:

• d5feab_ first appeared in SCOPe 2.05
  
• d5feab_ appears in SCOPe 2.06
  
• d5feab_ appears in the current release, SCOPe 2.08