Lineage for d5feab_ (5fea B:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. Protein automated matches [190615] (14 species)
    not a true protein
  7. Species Leishmania donovani [TaxId:981087] [274710] (2 PDB entries)
  8. Domain d5feab_: 5fea B: [280429]
    automated match to d2dvva_
    complexed with bmf, br

Details for d5feab_

PDB Entry: 5fea (more details), 2.6 Å

PDB Description: domain swapped bromodomain from leishmania donovani
PDB Compounds: (B:) Uncharacterized protein

SCOPe Domain Sequences for d5feab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5feab_ a.29.2.0 (B:) automated matches {Leishmania donovani [TaxId: 981087]}
khahrqsletipevaelyhciyklyneeessvwfrepvnalaqeiftyydvvkspmslrh
ildnivkgdtystalqvmedveliwkncitfngansllateagkcrsaldrirrayqddq
r

SCOPe Domain Coordinates for d5feab_ are not available.

Timeline for d5feab_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5feaa_