Lineage for d5farh_ (5far H:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1919500Fold d.96: T-fold [55619] (2 superfamilies)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. 1919501Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. 1920048Family d.96.1.0: automated matches [227243] (1 protein)
    not a true family
  6. 1920049Protein automated matches [227009] (9 species)
    not a true protein
  7. 1920061Species Bacillus cereus [TaxId:1053183] [280391] (1 PDB entry)
  8. 1920069Domain d5farh_: 5far H: [280407]
    automated match to d3o1kd_
    complexed with 9mg

Details for d5farh_

PDB Entry: 5far (more details), 2 Å

PDB Description: crystal structure of dihydroneopterin aldolase from bacillus anthracis complex with 9-methylguanine
PDB Compounds: (H:) 7,8-dihydroneopterin aldolase

SCOPe Domain Sequences for d5farh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5farh_ d.96.1.0 (H:) automated matches {Bacillus cereus [TaxId: 1053183]}
mdkiyihdmefygyhgvfpeenklgqrfkvdltveldlkragesddlehsvnygelfelc
rkvvedrtyklvesiaeniatdilkqyesisrctikvikpdppipghyravaveitrerp

SCOPe Domain Coordinates for d5farh_:

Click to download the PDB-style file with coordinates for d5farh_.
(The format of our PDB-style files is described here.)

Timeline for d5farh_: