Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.96: T-fold [55619] (2 superfamilies) beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234 tunnel-shaped: its known members form wide oligomeric barrels different sizes |
Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) bind purine or pterin in topologically similar sites between subunits |
Family d.96.1.0: automated matches [227243] (1 protein) not a true family |
Protein automated matches [227009] (9 species) not a true protein |
Species Bacillus cereus [TaxId:1053183] [280391] (1 PDB entry) |
Domain d5farh_: 5far H: [280407] automated match to d3o1kd_ complexed with 9mg |
PDB Entry: 5far (more details), 2 Å
SCOPe Domain Sequences for d5farh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5farh_ d.96.1.0 (H:) automated matches {Bacillus cereus [TaxId: 1053183]} mdkiyihdmefygyhgvfpeenklgqrfkvdltveldlkragesddlehsvnygelfelc rkvvedrtyklvesiaeniatdilkqyesisrctikvikpdppipghyravaveitrerp
Timeline for d5farh_: