SCOPe 2.08: Domain d5esvb2: 5esv B:107-212

Lineage for d5esvb2 (5esv B:107-212)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88569] (147 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)
   SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody

8. Domain d5esvb2: 5esv B:107-212 [280386]
   Other proteins in same PDB: d5esva_, d5esvb1, d5esvc_, d5esvd1, d5esvh_, d5esvl1
   automated match to d1dn0a2
   complexed with nag, zn

Details for d5esvb2

PDB Entry: 5esv, 3.11 Å

PDB Description: crystal structure of broadly neutralizing antibody ch03, isolated from donor ch0219, in complex with scaffolded trimeric hiv-1 env v1v2 domain from the clade c superinfecting strain of donor cap256.

PDB Compounds: (B:) CH03 Light Chain

SCOPe Domain Sequences for d5esvb2:

Sequence; same for both SEQRES and ATOM records:

>d5esvb2 b.1.1.2 (B:107-212) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rrtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

Timeline for d5esvb2:

• d5esvb2 first appeared in SCOPe 2.05
  
• d5esvb2 appears in SCOPe 2.07