Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
Domain d5esvb1: 5esv B:1-106 [280385] Other proteins in same PDB: d5esva_, d5esvb2, d5esvc_, d5esvd2, d5esvh_, d5esvl2 automated match to d1dn0a1 complexed with nag, zn |
PDB Entry: 5esv (more details), 3.11 Å
SCOPe Domain Sequences for d5esvb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5esvb1 b.1.1.0 (B:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]} eivltqspatlslspgeratlscrasqsvhpkyfawyqqkpgqsprlliysgstraagia drfsgggsgihftltitrvepedfavyfcqqyggspytfgqgtkvel
Timeline for d5esvb1: