SCOPe 2.08: Domain d5dvbh1: 5dvb H:1-167

Lineage for d5dvbh1 (5dvb H:1-167)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)

6. Protein automated matches [190100] (21 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [226432] (2 PDB entries)

8. Domain d5dvbh1: 5dvb H:1-167 [280346]
   Other proteins in same PDB: d5dvba2, d5dvbb2, d5dvbc2, d5dvbd2, d5dvbe2, d5dvbf2, d5dvbg2, d5dvbh2, d5dvbi2, d5dvbj2
   automated match to d3sbcb_

Details for d5dvbh1

PDB Entry: 5dvb, 2.2 Å

PDB Description: crystal structure of s. cerevisiae tsa2

PDB Compounds: (H:) Tsa2p

SCOPe Domain Sequences for d5dvbh1:

Sequence; same for both SEQRES and ATOM records:

>d5dvbh1 c.47.1.10 (H:1-167) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mvaevqkqappfkktavvdgifeeislekykgkyvvlafvplafsfvspteivafsdaak
kfedqgaqvlfastdseysllawtnlprkdgglgpvkvplladknhslsrdygvliekeg
ialrglfiidpkgiirhitindlsvgrnvnealrlvegfqwtdkngt

Timeline for d5dvbh1:

• d5dvbh1 first appeared in SCOPe 2.05, called d5dvbh_
  
• d5dvbh1 appears in SCOPe 2.07