Lineage for d5dvbb_ (5dvb B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1852416Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1852417Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1853530Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 1853871Protein automated matches [190100] (17 species)
    not a true protein
  7. 1854015Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [226432] (2 PDB entries)
  8. 1854017Domain d5dvbb_: 5dvb B: [280339]
    automated match to d3sbcb_

Details for d5dvbb_

PDB Entry: 5dvb (more details), 2.2 Å

PDB Description: crystal structure of s. cerevisiae tsa2
PDB Compounds: (B:) Tsa2p

SCOPe Domain Sequences for d5dvbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dvbb_ c.47.1.10 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gmvaevqkqappfkktavvdgifeeislekykgkyvvlafvplafsfvspteivafsdaa
kkfedqgaqvlfastdseysllawtnlprkdgglgpvkvplladknhslsrdygvlieke
gialrglfiidpkgiirhitindlsvgrnvnealrlvegfqwtdkngtvlpcnwtp

SCOPe Domain Coordinates for d5dvbb_:

Click to download the PDB-style file with coordinates for d5dvbb_.
(The format of our PDB-style files is described here.)

Timeline for d5dvbb_: