Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) |
Protein automated matches [190100] (17 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [226432] (2 PDB entries) |
Domain d5dvbb_: 5dvb B: [280339] automated match to d3sbcb_ |
PDB Entry: 5dvb (more details), 2.2 Å
SCOPe Domain Sequences for d5dvbb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5dvbb_ c.47.1.10 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} gmvaevqkqappfkktavvdgifeeislekykgkyvvlafvplafsfvspteivafsdaa kkfedqgaqvlfastdseysllawtnlprkdgglgpvkvplladknhslsrdygvlieke gialrglfiidpkgiirhitindlsvgrnvnealrlvegfqwtdkngtvlpcnwtp
Timeline for d5dvbb_: