SCOPe 2.06: Domain d5d8jl1: 5d8j L:1-108

Lineage for d5d8jl1 (5d8j L:1-108)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225523] (17 PDB entries)

8. Domain d5d8jl1: 5d8j L:1-108 [280322]
   Other proteins in same PDB: d5d8ja1, d5d8ja2, d5d8jl2
   automated match to d1h3pl1
   complexed with so4

Details for d5d8jl1

PDB Entry: 5d8j, 3 Å

PDB Description: development of a therapeutic monoclonal antibody targeting secreted ap2 to treat type 2 diabetes.

PDB Compounds: (L:) HA3 Fab Light Chain

SCOPe Domain Sequences for d5d8jl1:

Sequence; same for both SEQRES and ATOM records:

>d5d8jl1 b.1.1.0 (L:1-108) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
evvltqspalmaaspgekvtitcsvsssisssnlhwyqqksetspkpwiygtsnlasgvp
vrfsgsgsgtsysltissmeaedaatyycqqwshypltfgagtklelk

Timeline for d5d8jl1:

• d5d8jl1 first appeared in SCOPe 2.05
  
• d5d8jl1 appears in SCOPe 2.07
  
• d5d8jl1 appears in the current release, SCOPe 2.08