Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) alpha-beta(2)-alpha(2)-beta(3) |
Family d.110.3.0: automated matches [191387] (1 protein) not a true family |
Protein automated matches [190492] (16 species) not a true protein |
Species Phaeodactylum tricornutum [TaxId:2850] [280317] (2 PDB entries) |
Domain d5dkla_: 5dkl A: [280319] automated match to d3ue6e_ complexed with fmn |
PDB Entry: 5dkl (more details), 2.7 Å
SCOPe Domain Sequences for d5dkla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5dkla_ d.110.3.0 (A:) automated matches {Phaeodactylum tricornutum [TaxId: 2850]} gamgdfsfikalqtaqqnfvvtdpslpdnpivyasqgflnltgysldqilgrncrflqgp etdpkaverirkaieqgndmsvcllnyrvdgttfwnqffiaalrdaggnvtnfvgvqckv sdqyaatvtkqqe
Timeline for d5dkla_: