Lineage for d5dklb_ (5dkl B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2970038Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2970344Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 2970628Family d.110.3.0: automated matches [191387] (1 protein)
    not a true family
  6. 2970629Protein automated matches [190492] (24 species)
    not a true protein
  7. 2970774Species Phaeodactylum tricornutum [TaxId:2850] [280317] (4 PDB entries)
  8. 2970780Domain d5dklb_: 5dkl B: [280318]
    automated match to d3ue6e_
    complexed with fmn

Details for d5dklb_

PDB Entry: 5dkl (more details), 2.7 Å

PDB Description: structure of the light-state dimer of the blue light photoreceptor aureochrome 1a lov from p. tricornutum
PDB Compounds: (B:) LOV domain

SCOPe Domain Sequences for d5dklb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dklb_ d.110.3.0 (B:) automated matches {Phaeodactylum tricornutum [TaxId: 2850]}
gamgdfsfikalqtaqqnfvvtdpslpdnpivyasqgflnltgysldqilgrncrflqgp
etdpkaverirkaieqgndmsvcllnyrvdgttfwnqffiaalrdaggnvtnfvgvqckv
sdqyaatvtkqqeeeee

SCOPe Domain Coordinates for d5dklb_:

Click to download the PDB-style file with coordinates for d5dklb_.
(The format of our PDB-style files is described here.)

Timeline for d5dklb_: