Lineage for d5df8b2 (5df8 B:222-562)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3012718Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 3012719Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 3014129Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 3014130Protein automated matches [190857] (70 species)
    not a true protein
  7. 3014979Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [196777] (34 PDB entries)
  8. 3015006Domain d5df8b2: 5df8 B:222-562 [280314]
    Other proteins in same PDB: d5df8a1, d5df8b1
    automated match to d4kqra2
    complexed with 59f, cl, gol

Details for d5df8b2

PDB Entry: 5df8 (more details), 2 Å

PDB Description: crystal structure of penicillin-binding protein 3 from pseudomonas aeruginosa in complex with cefoperazone
PDB Compounds: (B:) Cell division protein

SCOPe Domain Sequences for d5df8b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5df8b2 e.3.1.0 (B:222-562) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
sidlrlqylahrelrnallengakagslvimdvktgeilamtnqptynpnnrrnlqpaam
rnramidvfepgstvkpfsmsaalasgrwkpsdivdvypgtlqigrytirdvsrnsrqld
ltgilikssnvgiskiafdigaesiysvmqqvglgqdtglgfpgervgnlpnhrkwpkae
tatlaygyglsvtaiqlahayaalandgksvplsmtrvdrvpdgvqvispevastvqgml
qqvveaqggvfraqvpgyhaagksgtarkvsvgtkgyrenayrslfagfapatdpriamv
vvidepskagyfgglvsapvfskvmagalrlmnvppdnlpt

SCOPe Domain Coordinates for d5df8b2:

Click to download the PDB-style file with coordinates for d5df8b2.
(The format of our PDB-style files is described here.)

Timeline for d5df8b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5df8b1