SCOPe 2.08: Domain d5d8ja1: 5d8j A:1-132

Lineage for d5d8ja1 (5d8j A:1-132)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
   ten-stranded meander beta-sheet folded upon itself
   relates to the common fold by opening the barrel and insertion of beta-hairpin

6. Protein Adipocyte lipid-binding protein, ALBP [50856] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [50857] (21 PDB entries)

8. Domain d5d8ja1: 5d8j A:1-132 [280306]
   Other proteins in same PDB: d5d8ja2, d5d8jh1, d5d8jh2, d5d8jl1, d5d8jl2
   automated match to d3p6da_
   complexed with so4

Details for d5d8ja1

PDB Entry: 5d8j, 3 Å

PDB Description: development of a therapeutic monoclonal antibody targeting secreted ap2 to treat type 2 diabetes.

PDB Compounds: (A:) Fatty acid-binding protein, adipocyte

SCOPe Domain Sequences for d5d8ja1:

Sequence; same for both SEQRES and ATOM records:

>d5d8ja1 b.60.1.2 (A:1-132) Adipocyte lipid-binding protein, ALBP {Mouse (Mus musculus) [TaxId: 10090]}
mcdafvgtwklvssenfddymkevgvgfatrkvagmakpnmiisvngdlvtirsestfkn
teisfklgvefdeitaddrkvksiitldggalvqvqkwdgksttikrkrdgdklvvecvm
kgvtstrvyera

Timeline for d5d8ja1:

• d5d8ja1 first appeared in SCOPe 2.05, called d5d8ja_
  
• d5d8ja1 appears in SCOPe 2.07