Lineage for d4d3ca1 (4d3c A:127-208)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1963115Fold g.14: Kringle-like [57439] (1 superfamily)
    disulfide-rich fold; nearly all-beta
  4. 1963116Superfamily g.14.1: Kringle-like [57440] (3 families) (S)
  5. 1963117Family g.14.1.1: Kringle modules [57441] (7 proteins)
  6. 1963241Protein automated matches [226950] (2 species)
    not a true protein
  7. 1963242Species Human (Homo sapiens) [TaxId:9606] [225942] (11 PDB entries)
  8. 1963257Domain d4d3ca1: 4d3c A:127-208 [280295]
    Other proteins in same PDB: d4d3cl1, d4d3cl2
    automated match to d3hn4a2

Details for d4d3ca1

PDB Entry: 4d3c (more details), 2.62 Å

PDB Description: crystal structure of the nk1 domain of hgf in complex with anti-hgf monoclonal antibody sfn68.
PDB Compounds: (A:) hepatocyte growth factor

SCOPe Domain Sequences for d4d3ca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4d3ca1 g.14.1.1 (A:127-208) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nciigkggsykgtvsitksgikcqpwssmiphehsflpssyrgkdlqenycrnprgeegg
pwcftsnpevryevcdipqcse

SCOPe Domain Coordinates for d4d3ca1:

Click to download the PDB-style file with coordinates for d4d3ca1.
(The format of our PDB-style files is described here.)

Timeline for d4d3ca1: