Lineage for d4cnrc_ (4cnr C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2811457Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2811458Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2811459Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
    automatically mapped to Pfam PF00194
  6. 2812658Protein automated matches [190681] (2 species)
    not a true protein
  7. 2812659Species Cow (Bos taurus) [TaxId:9913] [280270] (4 PDB entries)
  8. 2812666Domain d4cnrc_: 4cnr C: [280282]
    automated match to d1v9ic_
    complexed with zn

Details for d4cnrc_

PDB Entry: 4cnr (more details), 2.29 Å

PDB Description: surface residue engineering of bovine carbonic anhydrase to an extreme halophilic enzyme for potential application in postcombustion co2 capture
PDB Compounds: (C:) Carbonic anhydrase 2

SCOPe Domain Sequences for d4cnrc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cnrc_ b.74.1.1 (C:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
hwgydkhngpehwhkdfpiangerqspvdidtdavvqdpalkplaldygeatsrrmvndg
hsfnveyddsqdkavlkdgpltgtyrlvqfhfhwgssddqgsehtvdrkkyaaelhlvhw
ntkygdfgtaaqepdglavvgvflkvgdanpalqkvldaldsiktkgkstdfpnfdpgsl
lpnvldywtypgslttppllesvtwivlkepisvssqqmlkfrtlnfnaegepeelmlan
wrpaqplknrqvrgfpk

SCOPe Domain Coordinates for d4cnrc_:

Click to download the PDB-style file with coordinates for d4cnrc_.
(The format of our PDB-style files is described here.)

Timeline for d4cnrc_: