SCOPe 2.05: Domain d5c05a1: 5c05 A:65-268

Lineage for d5c05a1 (5c05 A:65-268)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families)

5. Family a.102.4.0: automated matches [227201] (1 protein)
   not a true family

6. Protein automated matches [226931] (7 species)
   not a true protein

7. Species Thymus vulgaris [TaxId:49992] [280258] (1 PDB entry)

8. Domain d5c05a1: 5c05 A:65-268 [280261]
   Other proteins in same PDB: d5c05a2, d5c05b2
   automated match to d2onha1
   complexed with edo

Details for d5c05a1

PDB Entry: 5c05, 1.65 Å

PDB Description: crystal structure of gamma-terpinene synthase from thymus vulgaris

PDB Compounds: (A:) Putative gamma-terpinene synthase

SCOPe Domain Sequences for d5c05a1:

Sequence; same for both SEQRES and ATOM records:

>d5c05a1 a.102.4.0 (A:65-268) automated matches {Thymus vulgaris [TaxId: 49992]}
vwnndfiqsfstdkykdekflkkkeeliaqvkvllntkmeavkqleliedlrnlgltyyf
edefkkiltsiynehkgfkneqvgdlyftslafrllrlhgfdvsedvfnffknedgsdfk
aslgentkdvlelyeasflirvgevtleqarvfstkilekkveegikdekllawiqhsla
lplhwriqrlearwfldaykarkd

Timeline for d5c05a1:

• d5c05a1 is new in SCOPe 2.05-stable
  
• d5c05a1 appears in SCOPe 2.06
  
• d5c05a1 appears in the current release, SCOPe 2.08