Lineage for d5aoga_ (5aog A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2005118Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2005119Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2005120Family a.93.1.1: CCP-like [48114] (5 proteins)
  6. 2005457Protein automated matches [190089] (8 species)
    not a true protein
  7. 2005504Species Sorghum (Sorghum bicolor) [TaxId:4558] [280251] (1 PDB entry)
  8. 2005505Domain d5aoga_: 5aog A: [280252]
    automated match to d1bgpa_
    complexed with ca, gol, hem, iac, na

Details for d5aoga_

PDB Entry: 5aog (more details), 1.27 Å

PDB Description: structure of sorghum peroxidase
PDB Compounds: (A:) cationic peroxidase spc4

SCOPe Domain Sequences for d5aoga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5aoga_ a.93.1.1 (A:) automated matches {Sorghum (Sorghum bicolor) [TaxId: 4558]}
qpplapglsfdfykrscpkaesivrsfvqdavrrdvglaagllrlhfhdcfvqgcdasvl
ldgsatgpgeqqappnltlrptafkaindihdrlhkecggtvvscsdvlalaardsvvvs
ggpsyrvplgrrdsasfatqqdvlsglppptaavpallavlskinldatdlvalsgghti
glghctsfedrlfprpdptlnatfagqlrrtcpakgtdrrtpldvrtpnafdnkyyvnlv
nreglftsdqdlfsnartralvdkfarsqrdffdqfafsvvkmgqikvltgtqgqirtnc
sarnaag

SCOPe Domain Coordinates for d5aoga_:

Click to download the PDB-style file with coordinates for d5aoga_.
(The format of our PDB-style files is described here.)

Timeline for d5aoga_: