Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) automatically mapped to Pfam PF02777 |
Family d.44.1.0: automated matches [227155] (1 protein) not a true family |
Protein automated matches [226860] (31 species) not a true protein |
Species Nematode (Caenorhabditis elegans) [TaxId:6239] [225669] (5 PDB entries) |
Domain d5ag2a2: 5ag2 A:86-194 [280237] Other proteins in same PDB: d5ag2a1, d5ag2c1, d5ag2c3 automated match to d3dc5a2 complexed with act, azi, mli, mn, so4 |
PDB Entry: 5ag2 (more details), 1.77 Å
SCOPe Domain Sequences for d5ag2a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ag2a2 d.44.1.0 (A:86-194) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]} gepskelmdtikrdfgsldnlqkrlsditiavqgsgwgwlgyckkdkilkiatcanqdpl egmvplfgidvwehayylqyknvrpdyvhaiwkianwkniserfanarq
Timeline for d5ag2a2: