Lineage for d5ag2a2 (5ag2 A:86-194)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2189807Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 2189808Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 2190092Family d.44.1.0: automated matches [227155] (1 protein)
    not a true family
  6. 2190093Protein automated matches [226860] (31 species)
    not a true protein
  7. 2190189Species Nematode (Caenorhabditis elegans) [TaxId:6239] [225669] (5 PDB entries)
  8. 2190196Domain d5ag2a2: 5ag2 A:86-194 [280237]
    Other proteins in same PDB: d5ag2a1, d5ag2c1, d5ag2c3
    automated match to d3dc5a2
    complexed with act, azi, mli, mn, so4

Details for d5ag2a2

PDB Entry: 5ag2 (more details), 1.77 Å

PDB Description: sod-3 azide complex
PDB Compounds: (A:) Superoxide dismutase [Mn] 2, mitochondrial

SCOPe Domain Sequences for d5ag2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ag2a2 d.44.1.0 (A:86-194) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
gepskelmdtikrdfgsldnlqkrlsditiavqgsgwgwlgyckkdkilkiatcanqdpl
egmvplfgidvwehayylqyknvrpdyvhaiwkianwkniserfanarq

SCOPe Domain Coordinates for d5ag2a2:

Click to download the PDB-style file with coordinates for d5ag2a2.
(The format of our PDB-style files is described here.)

Timeline for d5ag2a2: