SCOPe 2.08: Domain d5ag2a1: 5ag2 A:1-85

Lineage for d5ag2a1 (5ag2 A:1-85)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families)
   automatically mapped to Pfam PF00081

5. Family a.2.11.0: automated matches [227154] (1 protein)
   not a true family

6. Protein automated matches [226859] (39 species)
   not a true protein

7. Species Nematode (Caenorhabditis elegans) [TaxId:6239] [225668] (8 PDB entries)

8. Domain d5ag2a1: 5ag2 A:1-85 [280236]
   Other proteins in same PDB: d5ag2a2, d5ag2c2, d5ag2c3
   automated match to d3dc5a1
   complexed with act, azi, mli, mn, so4

Details for d5ag2a1

PDB Entry: 5ag2, 1.77 Å

PDB Description: sod-3 azide complex

PDB Compounds: (A:) Superoxide dismutase [Mn] 2, mitochondrial

SCOPe Domain Sequences for d5ag2a1:

Sequence; same for both SEQRES and ATOM records:

>d5ag2a1 a.2.11.0 (A:1-85) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
khtlpdlpfdyadlepvisheimqlhhqkhhatyvnnlnqieeklheavskgnlkeaial
qpalkfnggghinhsifwtnlakdg

Timeline for d5ag2a1:

• d5ag2a1 first appeared in SCOPe 2.05
  
• d5ag2a1 appears in SCOPe 2.07