SCOPe 2.05: Domain d4xg6a_: 4xg6 A:

Lineage for d4xg6a_ (4xg6 A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Tyrosine-protein kinase SYK [118131] (1 species)
   PTK group; SYK/ZAP-70 subfamily; non-membrane spanning protein tyrosine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [118132] (52 PDB entries)
   Uniprot P43405 363-635 # structure of the SH2 domain tandem region (9-265) is also known (55576)

8. Domain d4xg6a_: 4xg6 A: [280186]
   automated match to d3tuca_
   complexed with x6g

Details for d4xg6a_

PDB Entry: 4xg6, 2.4 Å

PDB Description: crystal structure of an inhibitor-bound syk

PDB Compounds: (A:) Tyrosine-protein kinase SYK

SCOPe Domain Sequences for d4xg6a_:

Sequence, based on SEQRES records:

>d4xg6a_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]}
vyldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilkneandpalkdellaean
vmqqldnpyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdkniielvhqvsmgm
kyleesnfvhrdlaarnvllvtqhyakisdfglskalradenyykaqthgkwpvkwyape
cinyykfssksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagcpremy
dlmnlcwtydvenrpgfaavelrlrnyyydvvnl

Sequence, based on observed residues (ATOM records):

>d4xg6a_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]}
vyldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilkneandpalkdellaean
vmqqldnpyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdkniielvhqvsmgm
kyleesnfvhrdlaarnvllvtqhyakisdfglskalradenyykaqthpvkwyapecin
yykfssksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagcpremydlm
nlcwtydvenrpgfaavelrlrnyyydvvnl

Timeline for d4xg6a_:

• d4xg6a_ is new in SCOPe 2.05-stable
  
• d4xg6a_ is called d4xg6a1 in SCOPe 2.06
  
• d4xg6a_ appears in the current release, SCOPe 2.08, called d4xg6a1