SCOPe 2.05: Domain d4rx6a_: 4rx6 A:

Lineage for d4rx6a_ (4rx6 A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.5: GlnB-like [54913] (6 families)
   form timeric structures with the orthogonally packed beta-sheets

5. Family d.58.5.0: automated matches [191474] (1 protein)
   not a true family

6. Protein automated matches [190753] (14 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:224308] [269820] (2 PDB entries)

8. Domain d4rx6a_: 4rx6 A: [280173]
   automated match to d2piia_
   complexed with atp

Details for d4rx6a_

PDB Entry: 4rx6, 2.6 Å

PDB Description: structure of b. subtilis glnk-atp complex to 2.6 angstrom

PDB Compounds: (A:) Nitrogen regulatory PII-like protein

SCOPe Domain Sequences for d4rx6a_:

Sequence, based on SEQRES records:

>d4rx6a_ d.58.5.0 (A:) automated matches {Bacillus subtilis [TaxId: 224308]}
amsgqmfkveivtrpanfeklkqelgkigvtsltfsnvhgcglqkahtelyrgvkiesnv
yerlkieivvskvpvdqvtetakrvlktgspgdgkifvyeisntinirtgeegpeal

Sequence, based on observed residues (ATOM records):

>d4rx6a_ d.58.5.0 (A:) automated matches {Bacillus subtilis [TaxId: 224308]}
amsgqmfkveivtrpanfeklkqelgkigvtsltfsnvhgcglqkakiesnvyerlkiei
vvskvpvdqvtetakrvlktgspgdgkifvyeisntinirtgeegpeal

Timeline for d4rx6a_:

• d4rx6a_ is new in SCOPe 2.05-stable
  
• d4rx6a_ is called d4rx6a1 in SCOPe 2.06
  
• d4rx6a_ appears in the current release, SCOPe 2.08, called d4rx6a1