Lineage for d1af0a1 (1af0 A:247-471)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) 
Fold b.79: beta-Roll [51119] (1 superfamily) Superfamily b.79.1: Metalloprotease, C-terminal domain [51120] (1 family) 
Family b.79.1.1: Metalloprotease, C-terminal domain [51121] (1 protein) Protein Metalloprotease, C-terminal domain [51122] (2 species) 
Species Serratia marcescens [TaxId:615] [51124] (4 PDB entries) 
Domain d1af0a1: 1af0 A:247-471 [28017]
Other proteins in same PDB: d1af0a2
Details for d1af0a1
PDB Entry: 1af0 (more details), 1.8 Å
PDB Description: serratia protease in complex with inhibitor
SCOP Domain Sequences for d1af0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1af0a1 b.79.1.1 (A:247-471) Metalloprotease, C-terminal domain {Serratia marcescens}
ganlstrtgdtvygfnsntgrdflsttsnsqkvifaawdaggndtfdfsgytanqrinln
eksfsdvgglkgnvsiaagvtienaiggsgndvivgnaannvlkggagndvlfggggade
lwggagkdifvfsaasdsapgasdwirdfqkgidkidlsffdkeansssfihfvdhfsgt
ageallsynassnvtdlsvnigghqapdflvkivgqvdvatdfiv
SCOP Domain Coordinates for d1af0a1:
Click to download the PDB-style file with coordinates for d1af0a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1af0a1:
- d1af0a1 first appeared (with stable ids) in SCOP 1.55
- d1af0a1 appears in SCOP 1.59
- d1af0a1 appears in SCOP 1.63
- d1af0a1 appears in the current release, SCOPe 2.08
View in 3D
