Class b: All beta proteins [48724] (119 folds) |
Fold b.79: beta-Roll [51119] (1 superfamily) contains a parallel beta-helix that binds calcium ions between its turns |
Superfamily b.79.1: Serralysin-like metalloprotease, C-terminal domain [51120] (1 family) duplication: halfturs of beta-helix are sequence and structural repeats |
Family b.79.1.1: Serralysin-like metalloprotease, C-terminal domain [51121] (1 protein) |
Protein Metalloprotease [51122] (4 species) The catalitic N-terminal domain belong to the "zincin" superfamily |
Species Serratia marcescens [TaxId:615] [51124] (4 PDB entries) serralysin |
Domain d1smpa1: 1smp A:247-471 [28016] Other proteins in same PDB: d1smpa2, d1smpi_ complexed with ca, zn |
PDB Entry: 1smp (more details), 2.3 Å
SCOP Domain Sequences for d1smpa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1smpa1 b.79.1.1 (A:247-471) Metalloprotease {Serratia marcescens} ganlstrtgdtvygfnsntgrdflsttsnsqkvifaawdaggndtfdfsgytanqrinln eksfsdvgglkgnvsiaagvtienaiggsgndvivgnaannvlkggagndvlfggggade lwggagkdifvfsaasdsapgasdwirdfqkgidkidlsffnkeanssdfihfvdhfsgt ageallsynassnvtdlsvnigghqapdflvkivgqvdvatdfiv
Timeline for d1smpa1: