Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
Superfamily c.52.1: Restriction endonuclease-like [52980] (35 families) |
Family c.52.1.34: PA N-terminal domain [254166] (2 proteins) Pfam PF00603; relationship to endonucleases discussed in PubMed 19194458 |
Protein PA N-terminal domain [254375] (5 species) |
Species Influenza a virus (strain a/puerto rico/8/1934 h1n1) [TaxId:211044] [272056] (5 PDB entries) |
Domain d5fdea_: 5fde A: [280155] automated match to d4e5ed_ complexed with 4p9, mn, so4 |
PDB Entry: 5fde (more details), 2.15 Å
SCOPe Domain Sequences for d5fdea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5fdea_ c.52.1.34 (A:) PA N-terminal domain {Influenza a virus (strain a/puerto rico/8/1934 h1n1) [TaxId: 211044]} gplgsmedfvrqcfnpmivelaektmkeygedlkietnkfaaicthlevcfmysdaskhr feiiegrdrtmawtvvnsicnttgaekpkflpdlydykenrfieigvtrrevhiyyleka nkiksekthihifsftgeematkadytldeesrariktrlftirqemasrglwdsfrqse r
Timeline for d5fdea_: