Lineage for d5fdea_ (5fde A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1856505Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 1856506Superfamily c.52.1: Restriction endonuclease-like [52980] (35 families) (S)
  5. 1856940Family c.52.1.34: PA N-terminal domain [254166] (2 proteins)
    Pfam PF00603; relationship to endonucleases discussed in PubMed 19194458
  6. 1856941Protein PA N-terminal domain [254375] (5 species)
  7. 1856954Species Influenza a virus (strain a/puerto rico/8/1934 h1n1) [TaxId:211044] [272056] (5 PDB entries)
  8. 1856958Domain d5fdea_: 5fde A: [280155]
    automated match to d4e5ed_
    complexed with 4p9, mn, so4

Details for d5fdea_

PDB Entry: 5fde (more details), 2.15 Å

PDB Description: endonuclease inhibitor 2 bound to influenza strain h1n1 polymerase acidic subunit n-terminal region at ph 7.0
PDB Compounds: (A:) Polymerase acidic protein,Polymerase acidic protein

SCOPe Domain Sequences for d5fdea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fdea_ c.52.1.34 (A:) PA N-terminal domain {Influenza a virus (strain a/puerto rico/8/1934 h1n1) [TaxId: 211044]}
gplgsmedfvrqcfnpmivelaektmkeygedlkietnkfaaicthlevcfmysdaskhr
feiiegrdrtmawtvvnsicnttgaekpkflpdlydykenrfieigvtrrevhiyyleka
nkiksekthihifsftgeematkadytldeesrariktrlftirqemasrglwdsfrqse
r

SCOPe Domain Coordinates for d5fdea_:

Click to download the PDB-style file with coordinates for d5fdea_.
(The format of our PDB-style files is described here.)

Timeline for d5fdea_:

  • d5fdea_ is new in SCOPe 2.05-stable
  • d5fdea_ last appears in SCOPe 2.06, called d5fdea1