Lineage for d1srp_1 (1srp 247-471)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 171496Fold b.79: beta-Roll [51119] (1 superfamily)
  4. 171497Superfamily b.79.1: Metalloprotease, C-terminal domain [51120] (1 family) (S)
  5. 171498Family b.79.1.1: Metalloprotease, C-terminal domain [51121] (1 protein)
  6. 171499Protein Metalloprotease, C-terminal domain [51122] (2 species)
  7. 171504Species Serratia marcescens [TaxId:615] [51124] (4 PDB entries)
  8. 171507Domain d1srp_1: 1srp 247-471 [28015]
    Other proteins in same PDB: d1srp_2

Details for d1srp_1

PDB Entry: 1srp (more details), 2 Å

PDB Description: structural analysis of serratia protease

SCOP Domain Sequences for d1srp_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1srp_1 b.79.1.1 (247-471) Metalloprotease, C-terminal domain {Serratia marcescens}
ganlstrtgdtvygfnsntgrdflsttsnsqkvifaawdaggndtfdfsgytanqrinln
eksfsdvgglkgnvsiaagvtienaiggsgndvivgnaannvlkggagndvlfggggade
lwggagkdifvfsaasdsapgasdwirdfqkgidkidlsffnkeaqssdfihfvdhfsga
ageallsynasnnvtdlsvnigghqapdflvkivgqvdvatdfiv

SCOP Domain Coordinates for d1srp_1:

Click to download the PDB-style file with coordinates for d1srp_1.
(The format of our PDB-style files is described here.)

Timeline for d1srp_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1srp_2