SCOPe 2.05: Domain d5e7fa_: 5e7f A:

Lineage for d5e7fa_ (5e7f A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (18 species)
   not a true protein

7. Species Camel (Camelus dromedarius) [TaxId:9838] [187219] (25 PDB entries)

8. Domain d5e7fa_: 5e7f A: [280146]
   automated match to d1kxtb_

Details for d5e7fa_

PDB Entry: 5e7f, 2.7 Å

PDB Description: complex between lactococcal phage tuc2009 rbp head domain and a nanobody (l06)

PDB Compounds: (A:) nanobody L06

SCOPe Domain Sequences for d5e7fa_:

Sequence; same for both SEQRES and ATOM records:

>d5e7fa_ b.1.1.1 (A:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
qvqlvesgggsvqaggslrlsctasgftfddsdmgwyhqapgnecelvsaifsdgstyya
dsvkgrftisrdnakntvylqmnslkpedtamyycaaatttvasppvrhvcngywgqgtq
vtvssh

Timeline for d5e7fa_:

• d5e7fa_ is new in SCOPe 2.05-stable
  
• d5e7fa_ is called d5e7fa1 in SCOPe 2.06
  
• d5e7fa_ appears in the current release, SCOPe 2.08, called d5e7fa1