Lineage for d5e7fb_ (5e7f B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1755448Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1757949Protein automated matches [190119] (18 species)
    not a true protein
  7. 1757950Species Camel (Camelus dromedarius) [TaxId:9838] [187219] (25 PDB entries)
  8. 1757996Domain d5e7fb_: 5e7f B: [280145]
    automated match to d1kxtb_

Details for d5e7fb_

PDB Entry: 5e7f (more details), 2.7 Å

PDB Description: complex between lactococcal phage tuc2009 rbp head domain and a nanobody (l06)
PDB Compounds: (B:) nanobody L06

SCOPe Domain Sequences for d5e7fb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5e7fb_ b.1.1.1 (B:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
qvqlvesgggsvqaggslrlsctasgftfddsdmgwyhqapgnecelvsaifsdgstyya
dsvkgrftisrdnakntvylqmnslkpedtamyycaaatttvasppvrhvcngywgqgtq
vtvss

SCOPe Domain Coordinates for d5e7fb_:

Click to download the PDB-style file with coordinates for d5e7fb_.
(The format of our PDB-style files is described here.)

Timeline for d5e7fb_: