Lineage for d5e0la_ (5e0l A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1902728Fold d.39: DLC [54647] (1 superfamily)
    core: beta-alpha(2)-beta-X-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 1342
  4. 1902729Superfamily d.39.1: DLC [54648] (1 family) (S)
    automatically mapped to Pfam PF01221
  5. 1902730Family d.39.1.1: DLC [54649] (3 proteins)
    8 kDa dynein light chain, DLC8
  6. 1902731Protein Dynein light chain 1 (DLC1) [54650] (3 species)
    synonym: PIN, a protein inhibitor of neuronal nitric oxide synthase
  7. 1902732Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [102918] (11 PDB entries)
  8. 1902733Domain d5e0la_: 5e0l A: [280142]
    automated match to d1rhwa_
    complexed with so4

Details for d5e0la_

PDB Entry: 5e0l (more details), 1.31 Å

PDB Description: lc8 - chica (415-424) complex
PDB Compounds: (A:) Dynein light chain 1, cytoplasmic

SCOPe Domain Sequences for d5e0la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5e0la_ d.39.1.1 (A:) Dynein light chain 1 (DLC1) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
drkaviknadmseemqqdavdcatqalekyniekdiaayikkefdkkynptwhcivgrnf
gsyvthetrhfiyfylgqvaillfksg

SCOPe Domain Coordinates for d5e0la_:

Click to download the PDB-style file with coordinates for d5e0la_.
(The format of our PDB-style files is described here.)

Timeline for d5e0la_: