SCOPe 2.01: Domain d1sata1: 1sat A:247-471

Lineage for d1sata1 (1sat A:247-471)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.80.7: beta-Roll [51120] (1 family)
   superhelix turns are made of two short strands each

5. Family b.80.7.1: Serralysin-like metalloprotease, C-terminal domain [51121] (1 protein)
   duplication: halfturs of beta-helix are sequence and structural repeats; binds calcium ions between the turns
   this is a repeat family; one repeat unit is 1go7 P:374-356 found in domain

6. Protein Metalloprotease [51122] (4 species)
   The catalytic N-terminal domain belong to the "zincin" superfamily

7. Species Serratia marcescens [TaxId:615] [51124] (4 PDB entries)
   serralysin

8. Domain d1sata1: 1sat A:247-471 [28014]
   Other proteins in same PDB: d1sata2
   complexed with ca, zn

Details for d1sata1

PDB Entry: 1sat, 1.75 Å

PDB Description: crystal structure of the 50 kda metallo protease from s. marcescens

PDB Compounds: (A:) serratia protease

SCOPe Domain Sequences for d1sata1:

Sequence; same for both SEQRES and ATOM records:

>d1sata1 b.80.7.1 (A:247-471) Metalloprotease {Serratia marcescens [TaxId: 615]}
ganlstrtgdtvygfnsntgrdflsttsnsqkvifaawdaggndtfdfsgytanqrinln
eksfsdvgglkgnvsiaagvtienaiggsgndvivgnaannvlkggagndvlfggggade
lwggagkdifvfsaasdsapgasdwirdfqkgidkidlsffdkeansssfihfvdhfsgt
ageallsynassnvtdlsvnigghaapdflvkivgqvdvatdfiv

Timeline for d1sata1:

• d1sata1 first appeared (with stable ids) in SCOP 1.55, called d1sat_1
  
• d1sata1 appears in SCOP 1.75
  
• d1sata1 appears in SCOPe 2.02
  
• d1sata1 appears in the current release, SCOPe 2.08