| Class b: All beta proteins [48724] (126 folds) |
| Fold b.79: beta-Roll [51119] (1 superfamily) contains a parallel beta-helix that binds calcium ions between its turns |
Superfamily b.79.1: Serralysin-like metalloprotease, C-terminal domain [51120] (1 family) ![]() duplication: halfturs of beta-helix are sequence and structural repeats |
| Family b.79.1.1: Serralysin-like metalloprotease, C-terminal domain [51121] (1 protein) |
| Protein Metalloprotease [51122] (4 species) The catalitic N-terminal domain belong to the "zincin" superfamily |
| Species Serratia marcescens [TaxId:615] [51124] (4 PDB entries) serralysin |
| Domain d1sat_1: 1sat 247-471 [28014] Other proteins in same PDB: d1sat_2 complexed with ca, zn |
PDB Entry: 1sat (more details), 1.75 Å
SCOP Domain Sequences for d1sat_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sat_1 b.79.1.1 (247-471) Metalloprotease {Serratia marcescens}
ganlstrtgdtvygfnsntgrdflsttsnsqkvifaawdaggndtfdfsgytanqrinln
eksfsdvgglkgnvsiaagvtienaiggsgndvivgnaannvlkggagndvlfggggade
lwggagkdifvfsaasdsapgasdwirdfqkgidkidlsffdkeansssfihfvdhfsgt
ageallsynassnvtdlsvnigghaapdflvkivgqvdvatdfiv
Timeline for d1sat_1: