SCOP 1.65: Domain d1sat_1: 1sat 247-471

Lineage for d1sat_1 (1sat 247-471)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.79: beta-Roll [51119] (1 superfamily)
   contains a parallel beta-helix that binds calcium ions between its turns

4. Superfamily b.79.1: Serralysin-like metalloprotease, C-terminal domain [51120] (1 family)
   duplication: halfturs of beta-helix are sequence and structural repeats

5. Family b.79.1.1: Serralysin-like metalloprotease, C-terminal domain [51121] (1 protein)

6. Protein Metalloprotease [51122] (4 species)
   The catalitic N-terminal domain belong to the "zincin" superfamily

7. Species Serratia marcescens [TaxId:615] [51124] (4 PDB entries)
   serralysin

8. Domain d1sat_1: 1sat 247-471 [28014]
   Other proteins in same PDB: d1sat_2
   complexed with ca, zn

Details for d1sat_1

PDB Entry: 1sat, 1.75 Å

PDB Description: crystal structure of the 50 kda metallo protease from s. marcescens

SCOP Domain Sequences for d1sat_1:

Sequence; same for both SEQRES and ATOM records:

>d1sat_1 b.79.1.1 (247-471) Metalloprotease {Serratia marcescens}
ganlstrtgdtvygfnsntgrdflsttsnsqkvifaawdaggndtfdfsgytanqrinln
eksfsdvgglkgnvsiaagvtienaiggsgndvivgnaannvlkggagndvlfggggade
lwggagkdifvfsaasdsapgasdwirdfqkgidkidlsffdkeansssfihfvdhfsgt
ageallsynassnvtdlsvnigghaapdflvkivgqvdvatdfiv

Timeline for d1sat_1:

• d1sat_1 first appeared (with stable ids) in SCOP 1.55
  
• d1sat_1 appears in SCOP 1.63
  
• d1sat_1 appears in SCOP 1.67
  
• d1sat_1 appears in the current release, SCOPe 2.08, called d1sata1