Lineage for d1sat_1 (1sat 247-471)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) 
Fold b.79: beta-Roll [51119] (1 superfamily) Superfamily b.79.1: Metalloprotease, C-terminal domain [51120] (1 family) 
Family b.79.1.1: Metalloprotease, C-terminal domain [51121] (1 protein) Protein Metalloprotease, C-terminal domain [51122] (2 species) 
Species Serratia marcescens [TaxId:615] [51124] (4 PDB entries) 
Domain d1sat_1: 1sat 247-471 [28014]
Other proteins in same PDB: d1sat_2
Details for d1sat_1
PDB Entry: 1sat (more details), 1.75 Å
PDB Description: crystal structure of the 50 kda metallo protease from s. marcescens
SCOP Domain Sequences for d1sat_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sat_1 b.79.1.1 (247-471) Metalloprotease, C-terminal domain {Serratia marcescens}
ganlstrtgdtvygfnsntgrdflsttsnsqkvifaawdaggndtfdfsgytanqrinln
eksfsdvgglkgnvsiaagvtienaiggsgndvivgnaannvlkggagndvlfggggade
lwggagkdifvfsaasdsapgasdwirdfqkgidkidlsffdkeansssfihfvdhfsgt
ageallsynassnvtdlsvnigghaapdflvkivgqvdvatdfiv
SCOP Domain Coordinates for d1sat_1:
Click to download the PDB-style file with coordinates for d1sat_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1sat_1:
- d1sat_1 first appeared (with stable ids) in SCOP 1.55
- d1sat_1 appears in SCOP 1.59
- d1sat_1 appears in SCOP 1.63
- d1sat_1 appears in the current release, SCOPe 2.08, called d1sata1
View in 3D
