Lineage for d1akl_1 (1akl 247-470)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 63476Fold b.79: beta-Roll [51119] (1 superfamily)
  4. 63477Superfamily b.79.1: Metalloprotease, C-terminal domain [51120] (1 family) (S)
  5. 63478Family b.79.1.1: Metalloprotease, C-terminal domain [51121] (1 protein)
  6. 63479Protein Metalloprotease, C-terminal domain [51122] (2 species)
  7. 63480Species Pseudomonas aeruginosa, alkaline protease [51123] (3 PDB entries)
  8. 63483Domain d1akl_1: 1akl 247-470 [28013]
    Other proteins in same PDB: d1akl_2

Details for d1akl_1

PDB Entry: 1akl (more details), 2 Å

PDB Description: alkaline protease from pseudomonas aeruginosa ifo3080

SCOP Domain Sequences for d1akl_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1akl_1 b.79.1.1 (247-470) Metalloprotease, C-terminal domain {Pseudomonas aeruginosa, alkaline protease}
ganlttrtgdtvygfnsnterdfysatssssklvfsvwdaggndtldfsgfsqnqkinln
ekalsdvgglkgnvsiaagvtvenaiggsgsdlligndvanvlkggagndilygglgadq
lwggagadtfvygdiaessaaapdtlrdfvsgqdkidlsgldafvngglvlqyvdafagk
agqailsydaaskagslaidfsgdahadfainligqatqadivv

SCOP Domain Coordinates for d1akl_1:

Click to download the PDB-style file with coordinates for d1akl_1.
(The format of our PDB-style files is described here.)

Timeline for d1akl_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1akl_2