Lineage for d1kapp1 (1kap P:247-470)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1329661Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 1329896Superfamily b.80.7: beta-Roll [51120] (2 families) (S)
    superhelix turns are made of two short strands each
  5. 1329897Family b.80.7.1: Serralysin-like metalloprotease, C-terminal domain [51121] (1 protein)
    duplication: halfturs of beta-helix are sequence and structural repeats; binds calcium ions between the turns
    this is a repeat family; one repeat unit is 1go7 P:374-356 found in domain
  6. 1329898Protein Metalloprotease [51122] (4 species)
    The catalytic N-terminal domain belong to the "zincin" superfamily
  7. 1329909Species Pseudomonas aeruginosa [TaxId:287] [51123] (3 PDB entries)
    alkaline protease
  8. 1329910Domain d1kapp1: 1kap P:247-470 [28012]
    Other proteins in same PDB: d1kapp2
    complexed with ca, zn

Details for d1kapp1

PDB Entry: 1kap (more details), 1.64 Å

PDB Description: three-dimensional structure of the alkaline protease of pseudomonas aeruginosa: a two-domain protein with a calcium binding parallel beta roll motif
PDB Compounds: (P:) alkaline protease

SCOPe Domain Sequences for d1kapp1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kapp1 b.80.7.1 (P:247-470) Metalloprotease {Pseudomonas aeruginosa [TaxId: 287]}
ganlttrtgdtvygfnsnterdfysatssssklvfsvwdaggndtldfsgfsqnqkinln
ekalsdvgglkgnvsiaagvtvenaiggsgsdlligndvanvlkggagndilygglgadq
lwggagadtfvygdiaessaaapdtlrdfvsgqdkidlsgldafvngglvlqyvdafagk
agqailsydaaskagslaidfsgdahadfainligqatqadivv

SCOPe Domain Coordinates for d1kapp1:

Click to download the PDB-style file with coordinates for d1kapp1.
(The format of our PDB-style files is described here.)

Timeline for d1kapp1: