SCOPe 2.02: Domain d1kapp1: 1kap P:247-470

Lineage for d1kapp1 (1kap P:247-470)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.80.7: beta-Roll [51120] (1 family)
   superhelix turns are made of two short strands each

5. Family b.80.7.1: Serralysin-like metalloprotease, C-terminal domain [51121] (1 protein)
   duplication: halfturs of beta-helix are sequence and structural repeats; binds calcium ions between the turns
   this is a repeat family; one repeat unit is 1go7 P:374-356 found in domain

6. Protein Metalloprotease [51122] (4 species)
   The catalytic N-terminal domain belong to the "zincin" superfamily

7. Species Pseudomonas aeruginosa [TaxId:287] [51123] (3 PDB entries)
   alkaline protease

8. Domain d1kapp1: 1kap P:247-470 [28012]
   Other proteins in same PDB: d1kapp2
   complexed with ca, zn

Details for d1kapp1

PDB Entry: 1kap, 1.64 Å

PDB Description: three-dimensional structure of the alkaline protease of pseudomonas aeruginosa: a two-domain protein with a calcium binding parallel beta roll motif

PDB Compounds: (P:) alkaline protease

SCOPe Domain Sequences for d1kapp1:

Sequence; same for both SEQRES and ATOM records:

>d1kapp1 b.80.7.1 (P:247-470) Metalloprotease {Pseudomonas aeruginosa [TaxId: 287]}
ganlttrtgdtvygfnsnterdfysatssssklvfsvwdaggndtldfsgfsqnqkinln
ekalsdvgglkgnvsiaagvtvenaiggsgsdlligndvanvlkggagndilygglgadq
lwggagadtfvygdiaessaaapdtlrdfvsgqdkidlsgldafvngglvlqyvdafagk
agqailsydaaskagslaidfsgdahadfainligqatqadivv

Timeline for d1kapp1:

• d1kapp1 first appeared (with stable ids) in SCOP 1.55
  
• d1kapp1 appears in SCOPe 2.01
  
• d1kapp1 appears in SCOPe 2.03
  
• d1kapp1 appears in the current release, SCOPe 2.08