SCOP 1.63: Domain d1kapp1: 1kap P:247-470

Lineage for d1kapp1 (1kap P:247-470)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.79: beta-Roll [51119] (1 superfamily)
   contains a parallel beta-helix that binds calcium ions between its turns

4. Superfamily b.79.1: Serralysin-like metalloprotease, C-terminal domain [51120] (1 family)
   duplication: halfturs of beta-helix are sequence and structural repeats

5. Family b.79.1.1: Serralysin-like metalloprotease, C-terminal domain [51121] (1 protein)

6. Protein Metalloprotease [51122] (4 species)
   The catalitic N-terminal domain belong to the "zincin" superfamily

7. Species Pseudomonas aeruginosa [TaxId:287] [51123] (3 PDB entries)
   alkaline protease

8. Domain d1kapp1: 1kap P:247-470 [28012]
   Other proteins in same PDB: d1kapp2
   complexed with ca, zn

Details for d1kapp1

PDB Entry: 1kap, 1.64 Å

PDB Description: three-dimensional structure of the alkaline protease of pseudomonas aeruginosa: a two-domain protein with a calcium binding parallel beta roll motif

SCOP Domain Sequences for d1kapp1:

Sequence; same for both SEQRES and ATOM records:

>d1kapp1 b.79.1.1 (P:247-470) Metalloprotease {Pseudomonas aeruginosa}
ganlttrtgdtvygfnsnterdfysatssssklvfsvwdaggndtldfsgfsqnqkinln
ekalsdvgglkgnvsiaagvtvenaiggsgsdlligndvanvlkggagndilygglgadq
lwggagadtfvygdiaessaaapdtlrdfvsgqdkidlsgldafvngglvlqyvdafagk
agqailsydaaskagslaidfsgdahadfainligqatqadivv

Timeline for d1kapp1:

• d1kapp1 first appeared (with stable ids) in SCOP 1.55
  
• d1kapp1 appears in SCOP 1.61
  
• d1kapp1 appears in SCOP 1.65
  
• d1kapp1 appears in the current release, SCOPe 2.08