Lineage for d1kapp1 (1kap P:247-470)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 171496Fold b.79: beta-Roll [51119] (1 superfamily)
  4. 171497Superfamily b.79.1: Metalloprotease, C-terminal domain [51120] (1 family) (S)
  5. 171498Family b.79.1.1: Metalloprotease, C-terminal domain [51121] (1 protein)
  6. 171499Protein Metalloprotease, C-terminal domain [51122] (2 species)
  7. 171500Species Pseudomonas aeruginosa, alkaline protease [51123] (3 PDB entries)
  8. 171501Domain d1kapp1: 1kap P:247-470 [28012]
    Other proteins in same PDB: d1kapp2

Details for d1kapp1

PDB Entry: 1kap (more details), 1.64 Å

PDB Description: three-dimensional structure of the alkaline protease of pseudomonas aeruginosa: a two-domain protein with a calcium binding parallel beta roll motif

SCOP Domain Sequences for d1kapp1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kapp1 b.79.1.1 (P:247-470) Metalloprotease, C-terminal domain {Pseudomonas aeruginosa, alkaline protease}
ganlttrtgdtvygfnsnterdfysatssssklvfsvwdaggndtldfsgfsqnqkinln
ekalsdvgglkgnvsiaagvtvenaiggsgsdlligndvanvlkggagndilygglgadq
lwggagadtfvygdiaessaaapdtlrdfvsgqdkidlsgldafvngglvlqyvdafagk
agqailsydaaskagslaidfsgdahadfainligqatqadivv

SCOP Domain Coordinates for d1kapp1:

Click to download the PDB-style file with coordinates for d1kapp1.
(The format of our PDB-style files is described here.)

Timeline for d1kapp1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kapp2