SCOPe 2.05: Domain d5c3nb_: 5c3n B:

Lineage for d5c3nb_ (5c3n B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.0: automated matches [191364] (1 protein)
   not a true family

6. Protein automated matches [190438] (20 species)
   not a true protein

7. Species Middle east respiratory syndrome coronavirus [TaxId:1335626] [272740] (5 PDB entries)

8. Domain d5c3nb_: 5c3n B: [280119]
   automated match to d2ynaa_

Details for d5c3nb_

PDB Entry: 5c3n, 3 Å

PDB Description: crystal structure of mers coronavirus main protease in spacegroup c2221

PDB Compounds: (B:) Orf1a protein

SCOPe Domain Sequences for d5c3nb_:

Sequence; same for both SEQRES and ATOM records:

>d5c3nb_ b.47.1.0 (B:) automated matches {Middle east respiratory syndrome coronavirus [TaxId: 1335626]}
sglvkmshpsgdveacmvqvtcgsmtlnglwldntvwcprhvmcpadqlsdpnydallis
mtnhsfsvqkhigapanlrvvghamqgtllkltvdvanpstpaytfttvkpgaafsvlac
yngrptgtftvvmrpnytikgsflcgscgsvgytkegsvinfcymhqmelangthtgsaf
dgtmygafmdkqvhqvqltdkycsvnvvawlyaailngcawfvkpnrtsvvsfnewalan
qftefvgtqsvdmlavktgvaieqllyaiqqlytgfqgkqilgstmledeftpedvnmqi

Timeline for d5c3nb_:

• d5c3nb_ is new in SCOPe 2.05-stable
  
• d5c3nb_ appears in SCOPe 2.06
  
• d5c3nb_ appears in the current release, SCOPe 2.08