SCOPe 2.05: Domain d4x4zb_: 4x4z B:

Lineage for d4x4zb_ (4x4z B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (18 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (120 PDB entries)

8. Domain d4x4zb_: 4x4z B: [280101]
   automated match to d1fvca_
   mutant

Details for d4x4zb_

PDB Entry: 4x4z, 1.8 Å

PDB Description: retrofitting antibodies with stabilizing mutations. herceptin vl mutant f53d.

PDB Compounds: (B:) Herceptin VL domain with F53D mutation

SCOPe Domain Sequences for d4x4zb_:

Sequence; same for both SEQRES and ATOM records:

>d4x4zb_ b.1.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqmtqspsslsasvgdrvtitcrasqdvntavawyqqkpgkapklliysasdlysgvpsr
fsgsrsgtdftltisslqpedfatyycqqhyttpptfgqgtkveik

Timeline for d4x4zb_:

• d4x4zb_ is new in SCOPe 2.05-stable
  
• d4x4zb_ appears in SCOPe 2.06
  
• d4x4zb_ appears in the current release, SCOPe 2.08