Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
Family c.1.9.3: Phosphotriesterase-like [51564] (3 proteins) automatically mapped to Pfam PF02126 |
Protein automated matches [190258] (2 species) not a true protein |
Species Brevundimonas diminuta [TaxId:293] [194088] (12 PDB entries) |
Domain d4xd4a_: 4xd4 A: [280100] automated match to d1qw7a_ complexed with cac, mpd, zn |
PDB Entry: 4xd4 (more details), 1.9 Å
SCOPe Domain Sequences for d4xd4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xd4a_ c.1.9.3 (A:) automated matches {Brevundimonas diminuta [TaxId: 293]} gdrintvrgpitiseagftlthehicgssagflrawpeffgsrkalaekavrglrraraa gvrtivdvstfdlgrdvsllaevsraadvhivaatglwldpplsmrlrsveeltqfflre iqygiedtgiragiikvattgkvtpfqelvlraaaraslatgvpvtthtaasqrggeqqa aifeseglspsrvcighsddtddlsyltalaargyligldriphsaiglednasasafmg irswqtrallikalidqgymkqilvsndwlfgissyvtnfmdvmdsvnpdgmafiplrvi pflrekgipqetlagitvtnparflsptl
Timeline for d4xd4a_: