Lineage for d4x4yd_ (4x4y D:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2355068Protein automated matches [190119] (22 species)
    not a true protein
  7. 2355178Species Human (Homo sapiens) [TaxId:9606] [188740] (320 PDB entries)
  8. 2355605Domain d4x4yd_: 4x4y D: [280099]
    Other proteins in same PDB: d4x4ya_, d4x4yc_
    automated match to d1fvcc_
    mutant

Details for d4x4yd_

PDB Entry: 4x4y (more details), 2.49 Å

PDB Description: retrofitting antibodies with stabilizing mutations. herceptin scfv mutant k30d/s52d.
PDB Compounds: (D:) Human Variable Light Chain of Herceptin

SCOPe Domain Sequences for d4x4yd_:

Sequence, based on SEQRES records: (download)

>d4x4yd_ b.1.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcrasqdvntavawyqqkpgkapklliysadflysgvps
rfsgsrsgtdftltisslqpedfatyycqqhyttpptfgqgtkve

Sequence, based on observed residues (ATOM records): (download)

>d4x4yd_ b.1.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcrasqdvntavawyqqkpgkapklliysadflysgsrs
gtdftltisslqpedfatyycqqhyttpptfgqgtkve

SCOPe Domain Coordinates for d4x4yd_:

Click to download the PDB-style file with coordinates for d4x4yd_.
(The format of our PDB-style files is described here.)

Timeline for d4x4yd_: