Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.1: Acetylcholinesterase-like [53475] (6 proteins) automatically mapped to Pfam PF00135 |
Protein automated matches [190065] (4 species) not a true protein |
Species Pacific electric ray (Torpedo californica) [TaxId:7787] [186783] (6 PDB entries) |
Domain d4x3ca_: 4x3c A: [280088] automated match to d1maaa_ complexed with nag, tnh |
PDB Entry: 4x3c (more details), 2.6 Å
SCOPe Domain Sequences for d4x3ca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4x3ca_ c.69.1.1 (A:) automated matches {Pacific electric ray (Torpedo californica) [TaxId: 7787]} dhsellvntksgkvmgtrvpvlsshisaflgipfaeppvgnmrfrrpepkkpwsgvwnas typnncqqyvdeqfpgfsgsemwnpnremsedclylniwvpsprpksttvmvwiygggfy sgsstldvyngkylayteevvlvslsyrvgafgflalhgsqeapgnvglldqrmalqwvh dniqffggdpktvtifgesaggasvgmhilspgsrdlfrrailqsgspncpwasvsvaeg rrravelgrnlncnlnsdeelihclrekkpqelidvewnvlpfdsifrfsfvpvidgeff ptslesmlnsgnfkktqillgvnkdegsffllygapgfskdseskisredfmsgvklsvp handlgldavtlqytdwmddnngiknrdglddivgdhnvicplmhfvnkytkfgngtyly ffnhrasnlvwpewmgvihgyeiefvfglplvkelnytaeeealsrrimhywatfaktgn pnephsqeskwplfttkeqkfidlntepmkvhqrlrvqmcvfwnqflpkllnat
Timeline for d4x3ca_: