Class b: All beta proteins [48724] (176 folds) |
Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.4: dUTPase-like [51283] (2 families) forms tight trimer through an additional beta-sheet in each subunit subunit beta-sheets are orthogonally packed around the three-fold axis |
Family b.85.4.0: automated matches [191644] (1 protein) not a true family |
Protein automated matches [191182] (12 species) not a true protein |
Species Staphylococcus phage [TaxId:12360] [227850] (2 PDB entries) |
Domain d4wrka_: 4wrk A: [280083] automated match to d4gv8c_ complexed with dup, mg; mutant |
PDB Entry: 4wrk (more details), 2.9 Å
SCOPe Domain Sequences for d4wrka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wrka_ b.85.4.0 (A:) automated matches {Staphylococcus phage [TaxId: 12360]} tntlqvrllsenarmpernhktdagydifsaetvvlepqekaviktdvavsipegyvgll tsrsgvsskthlvietgkidagyhgnlginiknnaiasngyitpgvfdikgeidlsdair qygtyqinegdklaqlvivpiwtpelkqveefesvser
Timeline for d4wrka_: