SCOPe 2.05: Domain d4wrkd_: 4wrk D:

Lineage for d4wrkd_ (4wrk D:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.4: dUTPase-like [51283] (2 families)
   forms tight trimer through an additional beta-sheet in each subunit
   subunit beta-sheets are orthogonally packed around the three-fold axis

5. Family b.85.4.0: automated matches [191644] (1 protein)
   not a true family

6. Protein automated matches [191182] (12 species)
   not a true protein

7. Species Staphylococcus phage [TaxId:12360] [227850] (2 PDB entries)

8. Domain d4wrkd_: 4wrk D: [280080]
   automated match to d4gv8c_
   complexed with dup, mg; mutant

Details for d4wrkd_

PDB Entry: 4wrk, 2.9 Å

PDB Description: the 3d structure of d95n mutant dutpase from phage phi11 of s. aureus reveals the molecular details for the coordination of a structural mg(ii) ion

PDB Compounds: (D:) dutpase

SCOPe Domain Sequences for d4wrkd_:

Sequence; same for both SEQRES and ATOM records:

>d4wrkd_ b.85.4.0 (D:) automated matches {Staphylococcus phage [TaxId: 12360]}
ntlqvrllsenarmpernhktdagydifsaetvvlepqekaviktdvavsipegyvgllt
srsgvsskthlvietgkidagyhgnlginiknnaiasngyitpgvfdikgeidlsdairq
ygtyqinegdklaqlvivpiwtpelkqveefes

Timeline for d4wrkd_:

• d4wrkd_ is new in SCOPe 2.05-stable
  
• d4wrkd_ appears in SCOPe 2.06
  
• d4wrkd_ appears in the current release, SCOPe 2.08