Lineage for d4wn3a_ (4wn3 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2891301Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2891302Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2891861Family c.61.1.0: automated matches [191528] (1 protein)
    not a true family
  6. 2891862Protein automated matches [190891] (38 species)
    not a true protein
  7. 2891915Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [280077] (1 PDB entry)
  8. 2891916Domain d4wn3a_: 4wn3 A: [280078]
    automated match to d2ps1a_
    complexed with 3r3, mg

Details for d4wn3a_

PDB Entry: 4wn3 (more details), 1.8 Å

PDB Description: crystal structure of saccharomyces cerevisiae omp synthase in complex with prp(nh)p
PDB Compounds: (A:) Orotate phosphoribosyltransferase 1

SCOPe Domain Sequences for d4wn3a_:

Sequence, based on SEQRES records: (download)

>d4wn3a_ c.61.1.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
imledyqknflelaiecqalrfgsfklksgrespyffnlglfntgkllsnlatayaiaii
qsdlkfdvifgpaykgiplaaivcvklaeiggskfqniqyafnrkeakdhgeggiivgsa
lenkriliiddvmtagtaineafeiisnakgqvvgsiialdrqevvstddkeglsatqtv
skkygipvlsivslihiitylegritaeekskieqylqtygas

Sequence, based on observed residues (ATOM records): (download)

>d4wn3a_ c.61.1.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
imledyqknflelaiecqalrfgsfklksgrespyffnlglfntgkllsnlatayaiaii
qsdlkfdvifgpaykgiplaaivcvklaeiggskfqniqyafnrkeakdggiivgsalen
kriliiddvmtagtaineafeiisnakgqvvgsiialdrqevvstddkeglsatqtvskk
ygipvlsivslihiitylegritaeekskieqylqtygas

SCOPe Domain Coordinates for d4wn3a_:

Click to download the PDB-style file with coordinates for d4wn3a_.
(The format of our PDB-style files is described here.)

Timeline for d4wn3a_: