SCOPe 2.05: Domain d4wdrb_: 4wdr B:

Lineage for d4wdrb_ (4wdr B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.8: Haloalkane dehalogenase [53513] (2 proteins)

6. Protein automated matches [190880] (4 species)
   not a true protein

7. Species Sphingobium japonicum [TaxId:452662] [280072] (1 PDB entry)

8. Domain d4wdrb_: 4wdr B: [280074]
   automated match to d1k63a_
   complexed with ca, cl; mutant

Details for d4wdrb_

PDB Entry: 4wdr, 2.5 Å

PDB Description: crystal structure of haloalkane dehalogenase linb 140a+143l+177w+211l mutant (linb86) from sphingobium japonicum ut26

PDB Compounds: (B:) haloalkane dehalogenase

SCOPe Domain Sequences for d4wdrb_:

Sequence; same for both SEQRES and ATOM records:

>d4wdrb_ c.69.1.8 (B:) automated matches {Sphingobium japonicum [TaxId: 452662]}
gakpfgekkfieikgrrmayidegtgdpilfqhgnptssylwrnimphcaglgrliacdl
igmgdsdkldpsgperyayaehrdyldalwealdlgdrvvlvvhdwgsalgfdwarrhre
rvqgiaymeaiampieaadlpeqdrdlfqafrsqageelvlqdnvfveqvlpgwilrpls
eaemaayrepflaagearrptlswprqlpiagtpadvvaiardyagwlsespipklfina
epgalttgrmrdfcrtwpnqteitvagahfiqedspdeigaaiaafvrrlrp

Timeline for d4wdrb_:

• d4wdrb_ is new in SCOPe 2.05-stable
  
• d4wdrb_ appears in SCOPe 2.06
  
• d4wdrb_ appears in the current release, SCOPe 2.08