Lineage for d4rabd_ (4rab D:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1863464Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 1863465Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 1863466Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)
  6. 1863558Protein Hypoxanthine-guanine PRTase (HGPRTase) [53283] (3 species)
  7. 1863559Species Human (Homo sapiens) [TaxId:9606] [53284] (17 PDB entries)
  8. 1863595Domain d4rabd_: 4rab D: [280059]
    automated match to d3gepa_
    complexed with 3l3, mg, po4

Details for d4rabd_

PDB Entry: 4rab (more details), 2.26 Å

PDB Description: aza-acyclic nucleoside phosphonates containing a second phosphonate group as inhibitors of the human, plasmodium falciparum and vivax 6- oxopurine phosphoribosyltransferases and their pro-drugs as antimalarial agents
PDB Compounds: (D:) hypoxanthine-guanine phosphoribosyltransferase

SCOPe Domain Sequences for d4rabd_:

Sequence, based on SEQRES records: (download)

>d4rabd_ c.61.1.1 (D:) Hypoxanthine-guanine PRTase (HGPRTase) {Human (Homo sapiens) [TaxId: 9606]}
spgvvisddepgydldlfcipnhyaedlervfiphglimdrterlardvmkemgghhiva
lcvlkggykffadlldyikalnrnsdrsipmtvdfirlksycndqstgdikviggddlst
ltgknvlivediidtgktmqtllslvrqynpkmvkvasllvkrtprsvgykpdfvgfeip
dkfvvgyaldyneyfrdlnhvcvisetgkakyka

Sequence, based on observed residues (ATOM records): (download)

>d4rabd_ c.61.1.1 (D:) Hypoxanthine-guanine PRTase (HGPRTase) {Human (Homo sapiens) [TaxId: 9606]}
spgvvisddepgydldlfcipnhyaedlervfiphglimdrterlardvmkemgghhiva
lcvlkggykffadlldyikalnrnsdrsipmtvdfirlkviggddlstltgknvlivedi
idtgktmqtllslvrqynpkmvkvasllvkrtprsvgykpdfvgfeipdkfvvgyaldyn
eyfrdlnhvcvisetgkakyka

SCOPe Domain Coordinates for d4rabd_:

Click to download the PDB-style file with coordinates for d4rabd_.
(The format of our PDB-style files is described here.)

Timeline for d4rabd_: