Class g: Small proteins [56992] (92 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.6: omega toxin-like [57059] (5 families) |
Family g.3.6.2: Spider toxins [57072] (26 proteins) |
Protein automated matches [254476] (6 species) not a true protein |
Species Haplopelma hainanum [TaxId:209901] [274882] (2 PDB entries) |
Domain d2mxoa_: 2mxo A: [280036] automated match to d1nixa_ mutant |
PDB Entry: 2mxo (more details)
SCOPe Domain Sequences for d2mxoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2mxoa_ g.3.6.2 (A:) automated matches {Haplopelma hainanum [TaxId: 209901]} aeckgfwkscvpgkneccsgyacssrdkwckvll
Timeline for d2mxoa_: