Lineage for d2mxoa_ (2mxo A:)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1960255Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1960563Superfamily g.3.6: omega toxin-like [57059] (5 families) (S)
  5. 1960604Family g.3.6.2: Spider toxins [57072] (26 proteins)
  6. 1960693Protein automated matches [254476] (6 species)
    not a true protein
  7. 1960698Species Haplopelma hainanum [TaxId:209901] [274882] (2 PDB entries)
  8. 1960700Domain d2mxoa_: 2mxo A: [280036]
    automated match to d1nixa_
    mutant

Details for d2mxoa_

PDB Entry: 2mxo (more details)

PDB Description: nmr structure of spider toxin- g7w/n24s mutant of trtx-hhn2b
PDB Compounds: (A:) Mu-theraphotoxin-Hhn2b

SCOPe Domain Sequences for d2mxoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mxoa_ g.3.6.2 (A:) automated matches {Haplopelma hainanum [TaxId: 209901]}
aeckgfwkscvpgkneccsgyacssrdkwckvll

SCOPe Domain Coordinates for d2mxoa_:

Click to download the PDB-style file with coordinates for d2mxoa_.
(The format of our PDB-style files is described here.)

Timeline for d2mxoa_: